Get your own Private Tracker Now!
Get your own Free Tracker Now!


Home  |  Lost My Code / My Account / Support

FG Edit 
  URL:    http://faernynsgrove.com  
  Counting since:    2 September 1999 /  20:06
  Current report:    26 Sep 2017  /  19:26
  > Summary  
  Unique Visitors  
  Incl, Excl, Reloads  
  Geo Tracking  
  System Tracking  
  Referrer Tracking 1  
  Referrer Tracking 2  

Free Daily Content For Your Website
Free daily content for your website - Word of the Day, Article of the Day, This day
in history, Today's birthday, Quote of the Day. Also: Reference lookup box, Javascript double-click code. Easy-to-use wizard generates HTML code for your page.

SummaryPeriod: 900 Days
  Daily Unique:     Totals:  
    Today       1  /  26 Sep, Tue, 2017     Unique Visitors      2351 - 91.76% 
    Yesterday       2  /  25 Sep, Mon, 2017     Visits incl. Reloads      2562 
    Average       2     Reloads      211 - 8.23% 
    Highest Day       17  /  17 Apr, Thu, 2014     Visitors via Referrers      1589 - 67.58% 
  Weekly Unique:        Website Referrers      173 
    Current Week         1  /  Wk 52, 2017     Javascript Enabled      2226 - 94.68%
    Last Week          3  /  Wk 39, 2017    
    Average       12   Most accessed:  
    Highest Week       42  /  Wk 33, 2014     Browser      Netscape 7 
  Monthly Unique:          Operating System      Windows NT 
    Current Month    23  /  Sep, 2017     Screen Resolution      Other 
    Last Month          29  /  Aug, 2017     Screen Color      32 Bit (16.7M) 
    Average       53     Searchengine      Google 
    Highest Month       154  /  Dec, 2014     Keyword      httpwwwgooglecomsearchqcachehttpwwwfaernynsgrovecom  
  Highest Hour of the Day       01:00 - 01:59     Domain/Country      .com / United States 
  Highest Day of the Week      Friday     Continent      North America 

Summary | Unique | Reloads | Geo | System | Referrer 1 | Referrer 2
 

Copyright © 1998-2017 eXTReMe digital. All Rights Reserved.  |  Privacy Policy