Get your own Private Tracker Now!
Get your own Free Tracker Now!


Home  |  Lost My Code / My Account / Support

FG Edit 
  URL:    http://faernynsgrove.com  
  Counting since:    2 September 1999 /  20:06
  Current report:    12 May 2024  /  12:23
  > Summary  
  Unique Visitors  
  Incl, Excl, Reloads  
  Geo Tracking  
  System Tracking  
  Referrer Tracking 1  
  Referrer Tracking 2  

Free Daily Content For Your Website
Free daily content for your website - Word of the Day, Article of the Day, This day
in history, Today's birthday, Quote of the Day. Also: Reference lookup box, Javascript double-click code. Easy-to-use wizard generates HTML code for your page.

SummaryPeriod: 1680 Days
  Daily Unique:     Totals:  
    Today       1  /  16 Dec, Sat, 2023     Unique Visitors      3469 - 92.55% 
    Yesterday       1  /  15 Dec, Fri, 2023     Visits incl. Reloads      3748 
    Average       2     Reloads      279 - 7.44% 
    Highest Day       17  /  17 Apr, Thu, 2014     Visitors via Referrers      1968 - 56.73% 
  Weekly Unique:        Website Referrers      209 
    Current Week         2  /  Wk 50, 2023     Javascript Enabled      3320 - 95.70%
    Last Week          1  /  Wk 45, 2022    
    Average       8   Most accessed:  
    Highest Week       42  /  Wk 33, 2014     Browser      Netscape 7 
  Monthly Unique:          Operating System      Windows NT 
    Current Month    2  /  Dec, 2023     Screen Resolution      Other 
    Last Month          1  /  Nov, 2022     Screen Color      24 Bit (16.7M) 
    Average       36     Searchengine      Google 
    Highest Month       154  /  Dec, 2014     Keyword      httpwwwgooglecomsearchqcachehttpwwwfaernynsgrovecom  
  Highest Hour of the Day       20:00 - 20:59     Domain/Country      .com / United States 
  Highest Day of the Week      Thursday     Continent      North America 

Summary | Unique | Reloads | Geo | System | Referrer 1 | Referrer 2
 

Copyright © 1998-2024 eXTReMe digital. All Rights Reserved.  |  Privacy Policy