Get your own Private Tracker Now!
Get your own Free Tracker Now!

Home  |  Lost My Code / My Account / Support

FG Edit 
  Counting since:    2 September 1999 /  20:06
  Current report:    24 Apr 2018  /  10:05
  > Summary  
  Unique Visitors  
  Incl, Excl, Reloads  
  Geo Tracking  
  System Tracking  
  Referrer Tracking 1  
  Referrer Tracking 2  

Free Daily Content For Your Website
Free daily content for your website - Word of the Day, Article of the Day, This day
in history, Today's birthday, Quote of the Day. Also: Reference lookup box, Javascript double-click code. Easy-to-use wizard generates HTML code for your page.

SummaryPeriod: 1013 Days
  Daily Unique:     Totals:  
    Today       1  /  24 Apr, Tue, 2018     Unique Visitors      2503 - 91.88% 
    Yesterday       1  /  23 Apr, Mon, 2018     Visits incl. Reloads      2724 
    Average       2     Reloads      221 - 8.11% 
    Highest Day       17  /  17 Apr, Thu, 2014     Visitors via Referrers      1605 - 64.12% 
  Weekly Unique:        Website Referrers      175 
    Current Week         2  /  Wk 17, 2018     Javascript Enabled      2375 - 94.88%
    Last Week          6  /  Wk 16, 2018    
    Average       11   Most accessed:  
    Highest Week       42  /  Wk 33, 2014     Browser      Netscape 7 
  Monthly Unique:          Operating System      Windows NT 
    Current Month    23  /  Apr, 2018     Screen Resolution      Other 
    Last Month          20  /  Mar, 2018     Screen Color      32 Bit (16.7M) 
    Average       49     Searchengine      Google 
    Highest Month       154  /  Dec, 2014     Keyword      httpwwwgooglecomsearchqcachehttpwwwfaernynsgrovecom  
  Highest Hour of the Day       01:00 - 01:59     Domain/Country      .com / United States 
  Highest Day of the Week      Thursday     Continent      North America 

Summary | Unique | Reloads | Geo | System | Referrer 1 | Referrer 2

Copyright © 1998-2018 eXTReMe digital. All Rights Reserved.  |  Privacy Policy